Lineage for d3am9b6 (3am9 B:695-1332)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1432242Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 1432243Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
    automatically mapped to Pfam PF02738
  5. 1432244Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (7 proteins)
  6. 1432303Protein Xanthine oxidase, C-terminal domain [56008] (1 species)
  7. 1432304Species Cow (Bos taurus) [TaxId:9913] [56009] (11 PDB entries)
    Uniprot P80457
  8. 1432316Domain d3am9b6: 3am9 B:695-1332 [208257]
    Other proteins in same PDB: d3am9a1, d3am9a2, d3am9a3, d3am9a4, d3am9a5, d3am9b1, d3am9b2, d3am9b3, d3am9b4, d3am9b5
    automated match to d1v97a5
    complexed with bct, ca, fad, fes, fyo, gol, mos, mte

Details for d3am9b6

PDB Entry: 3am9 (more details), 2.17 Å

PDB Description: Complex of bovine xanthine dehydrogenase and trihydroxy FYX-051
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3am9b6:

Sequence, based on SEQRES records: (download)

>d3am9b6 d.133.1.1 (B:695-1332) Xanthine oxidase, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk
geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval
aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls
hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc
glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk
krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal
kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe
dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl
rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs
iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf
rldspatpekirnacvdkfttlcvtgapgnckpwslrv

Sequence, based on observed residues (ATOM records): (download)

>d3am9b6 d.133.1.1 (B:695-1332) Xanthine oxidase, C-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
iitiedaiknnsfygselkiekgdlkkgfseadnvvsgelyiggqdhfylethctiaipk
geegemelfvstqnamktqsfvakmlgvpvnrilvrvkrmgggfggketrstlvsvaval
aayktghpvrcmldrnedmlitggrhpflarykvgfmktgtivalevdhysnagnsrdls
hsimeralfhmdncykipnirgtgrlcktnlssntafrgfggpqalfiaenwmsevavtc
glpaeevrwknmykegdlthfnqrlegfsvprcwdeclkssqyyarksevdkfnkencwk
krglciiptkfgisftvpflnqagalihvytdgsvlvshggtemgqglhtkmvqvaskal
kipiskiyisetstntvpnssptaasvstdiygqavyeacqtilkrlepfkkknpdgswe
dwvmaayqdrvslsttgfyrtpnlgysfetnsgnafhyftygvacseveidcltgdhknl
rtdivmdvgsslnpaidigqvegafvqglglftleelhyspegslhtrgpstykipafgs
iptefrvsllrdcpnkkaiyaskavgepplflgasvffaikdairaaraqhtnnntkelf
rldspatpekirnacvdkfttlcvnckpwslrv

SCOPe Domain Coordinates for d3am9b6:

Click to download the PDB-style file with coordinates for d3am9b6.
(The format of our PDB-style files is described here.)

Timeline for d3am9b6: