| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
| Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
| Protein Xanthine oxidase, N-terminal domain [54318] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [54319] (11 PDB entries) Uniprot P80457 |
| Domain d3am9b1: 3am9 B:3-92 [208252] Other proteins in same PDB: d3am9a2, d3am9a3, d3am9a4, d3am9a5, d3am9a6, d3am9b2, d3am9b3, d3am9b4, d3am9b5, d3am9b6 automated match to d1v97a2 complexed with bct, ca, fad, fes, fyo, gol, mos, mte |
PDB Entry: 3am9 (more details), 2.17 Å
SCOPe Domain Sequences for d3am9b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3am9b1 d.15.4.2 (B:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
dkiihfsanaclapictlhhvavttvegig
Timeline for d3am9b1: