Lineage for d3am9b1 (3am9 B:3-92)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2540890Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2541095Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2541241Protein Xanthine oxidase, N-terminal domain [54318] (1 species)
  7. 2541242Species Cow (Bos taurus) [TaxId:9913] [54319] (11 PDB entries)
    Uniprot P80457
  8. 2541250Domain d3am9b1: 3am9 B:3-92 [208252]
    Other proteins in same PDB: d3am9a2, d3am9a3, d3am9a4, d3am9a5, d3am9a6, d3am9b2, d3am9b3, d3am9b4, d3am9b5, d3am9b6
    automated match to d1v97a2
    complexed with bct, ca, fad, fes, fyo, gol, mos, mte

Details for d3am9b1

PDB Entry: 3am9 (more details), 2.17 Å

PDB Description: Complex of bovine xanthine dehydrogenase and trihydroxy FYX-051
PDB Compounds: (B:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3am9b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3am9b1 d.15.4.2 (B:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
adelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrlq
dkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d3am9b1:

Click to download the PDB-style file with coordinates for d3am9b1.
(The format of our PDB-style files is described here.)

Timeline for d3am9b1: