Lineage for d3am9a5 (3am9 A:537-694)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1902857Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1902858Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) (S)
  5. 1902859Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins)
  6. 1902920Protein Xanthine oxidase, domain 5 (?) [54670] (1 species)
  7. 1902921Species Cow (Bos taurus) [TaxId:9913] [54671] (11 PDB entries)
    Uniprot P80457
  8. 1902930Domain d3am9a5: 3am9 A:537-694 [208250]
    Other proteins in same PDB: d3am9a1, d3am9a2, d3am9a3, d3am9a4, d3am9a6, d3am9b1, d3am9b2, d3am9b3, d3am9b4, d3am9b6
    automated match to d1fo4a3
    complexed with bct, ca, fad, fes, fyo, gol, mos, mte

Details for d3am9a5

PDB Entry: 3am9 (more details), 2.17 Å

PDB Description: Complex of bovine xanthine dehydrogenase and trihydroxy FYX-051
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3am9a5:

Sequence; same for both SEQRES and ATOM records: (download)

>d3am9a5 d.41.1.1 (A:537-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus) [TaxId: 9913]}
kldptytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddi
pryenelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfa
kdtvtcvghiigavvadtpehaeraahvvkvtyedlpa

SCOPe Domain Coordinates for d3am9a5:

Click to download the PDB-style file with coordinates for d3am9a5.
(The format of our PDB-style files is described here.)

Timeline for d3am9a5: