| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) ![]() |
| Family d.41.1.1: CO dehydrogenase molybdoprotein N-domain-like [54666] (6 proteins) |
| Protein Xanthine oxidase, domain 5 (?) [54670] (1 species) |
| Species Cow (Bos taurus) [TaxId:9913] [54671] (11 PDB entries) Uniprot P80457 |
| Domain d3am9a5: 3am9 A:537-694 [208250] Other proteins in same PDB: d3am9a1, d3am9a2, d3am9a3, d3am9a4, d3am9a6, d3am9b1, d3am9b2, d3am9b3, d3am9b4, d3am9b6 automated match to d1fo4a3 complexed with bct, ca, fad, fes, fyo, gol, mos, mte |
PDB Entry: 3am9 (more details), 2.17 Å
SCOPe Domain Sequences for d3am9a5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3am9a5 d.41.1.1 (A:537-694) Xanthine oxidase, domain 5 (?) {Cow (Bos taurus) [TaxId: 9913]}
kldptytsatllfqkhppaniqlfqevpngqskedtvgrplphlaaamqasgeavycddi
pryenelflrlvtstrahakiksidvseaqkvpgfvcflsaddipgsnetglfndetvfa
kdtvtcvghiigavvadtpehaeraahvvkvtyedlpa
Timeline for d3am9a5: