Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) automatically mapped to Pfam PF03450 |
Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins) |
Protein Xanthine oxidase, domain 4 (?) [55452] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [55453] (10 PDB entries) Uniprot P80457 |
Domain d3am9a4: 3am9 A:415-530 [208249] Other proteins in same PDB: d3am9a1, d3am9a2, d3am9a3, d3am9a5, d3am9a6, d3am9b1, d3am9b2, d3am9b3, d3am9b5, d3am9b6 automated match to d1fo4a4 complexed with bct, ca, fad, fes, fyo, gol, mos, mte |
PDB Entry: 3am9 (more details), 2.17 Å
SCOPe Domain Sequences for d3am9a4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3am9a4 d.87.2.1 (A:415-530) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]} deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkd
Timeline for d3am9a4: