Lineage for d3am9a4 (3am9 A:415-530)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962998Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) (S)
    automatically mapped to Pfam PF03450
  5. 2962999Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins)
  6. 2963037Protein Xanthine oxidase, domain 4 (?) [55452] (1 species)
  7. 2963038Species Cow (Bos taurus) [TaxId:9913] [55453] (10 PDB entries)
    Uniprot P80457
  8. 2963045Domain d3am9a4: 3am9 A:415-530 [208249]
    Other proteins in same PDB: d3am9a1, d3am9a2, d3am9a3, d3am9a5, d3am9a6, d3am9b1, d3am9b2, d3am9b3, d3am9b5, d3am9b6
    automated match to d1fo4a4
    complexed with bct, ca, fad, fes, fyo, gol, mos, mte

Details for d3am9a4

PDB Entry: 3am9 (more details), 2.17 Å

PDB Description: Complex of bovine xanthine dehydrogenase and trihydroxy FYX-051
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3am9a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3am9a4 d.87.2.1 (A:415-530) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]}
deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql
skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklgkd

SCOPe Domain Coordinates for d3am9a4:

Click to download the PDB-style file with coordinates for d3am9a4.
(The format of our PDB-style files is described here.)

Timeline for d3am9a4: