Lineage for d3am9a3 (3am9 A:192-414)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2547890Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2547891Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2547987Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2548025Protein Xanthine oxidase, domain 3 (?) [56191] (1 species)
  7. 2548026Species Cow (Bos taurus) [TaxId:9913] [56192] (10 PDB entries)
    Uniprot P80457
  8. 2548033Domain d3am9a3: 3am9 A:192-414 [208248]
    Other proteins in same PDB: d3am9a1, d3am9a2, d3am9a4, d3am9a5, d3am9a6, d3am9b1, d3am9b2, d3am9b4, d3am9b5, d3am9b6
    automated match to d1fo4a6
    complexed with bct, ca, fad, fes, fyo, gol, mos, mte

Details for d3am9a3

PDB Entry: 3am9 (more details), 2.17 Å

PDB Description: Complex of bovine xanthine dehydrogenase and trihydroxy FYX-051
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3am9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3am9a3 d.145.1.3 (A:192-414) Xanthine oxidase, domain 3 (?) {Cow (Bos taurus) [TaxId: 9913]}
spslfnpeefmpldptqepifppellrlkdvppkqlrfegervtwiqastlkelldlkaq
hpeaklvvgnteigiemkfknqlfpmiicpawipelnavehgpegisfgaacalssvekt
lleavaklptqktevfrgvleqlrwfagkqvksvaslggniitaspisdlnpvfmasgtk
ltivsrgtrrtvpmdhtffpsyrktllgpeeillsieipysre

SCOPe Domain Coordinates for d3am9a3:

Click to download the PDB-style file with coordinates for d3am9a3.
(The format of our PDB-style files is described here.)

Timeline for d3am9a3: