Lineage for d3am9a2 (3am9 A:93-165)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715250Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2715251Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2715252Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2715311Protein Xanthine oxidase, domain 2 [47746] (1 species)
  7. 2715312Species Cow (Bos taurus) [TaxId:9913] [47747] (11 PDB entries)
    Uniprot P80457
  8. 2715319Domain d3am9a2: 3am9 A:93-165 [208247]
    Other proteins in same PDB: d3am9a1, d3am9a3, d3am9a4, d3am9a5, d3am9a6, d3am9b1, d3am9b3, d3am9b4, d3am9b5, d3am9b6
    automated match to d1fo4a1
    complexed with bct, ca, fad, fes, fyo, gol, mos, mte

Details for d3am9a2

PDB Entry: 3am9 (more details), 2.17 Å

PDB Description: Complex of bovine xanthine dehydrogenase and trihydroxy FYX-051
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3am9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3am9a2 a.56.1.1 (A:93-165) Xanthine oxidase, domain 2 {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOPe Domain Coordinates for d3am9a2:

Click to download the PDB-style file with coordinates for d3am9a2.
(The format of our PDB-style files is described here.)

Timeline for d3am9a2: