Lineage for d3ainc_ (3ain C:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2153506Species Sulfolobus tokodaii [TaxId:111955] [226148] (5 PDB entries)
  8. 2153509Domain d3ainc_: 3ain C: [208235]
    automated match to d1evqa_
    complexed with mpd, mrd, po4; mutant

Details for d3ainc_

PDB Entry: 3ain (more details), 1.65 Å

PDB Description: R267G mutant of a HSL-like carboxylesterase from Sulfolobus tokodaii
PDB Compounds: (C:) 303aa long hypothetical esterase

SCOPe Domain Sequences for d3ainc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ainc_ c.69.1.0 (C:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
asveeirslfkqfssltpreevgkieditipgsetnikarvyypktqgpygvlvyyhggg
fvlgdiesydplcraitnscqcvtisvdyrlapenkfpaavvdsfdalkwvynnsekfng
kygiavggdsaggnlaavtailskkeniklkyqvliypavsfdlitkslydngegffltr
ehidwfgqqylrsfadlldfrfspiladlndlppaliitaehdplrdqgeayankllqsg
vqvtsvgfnnvihgfvsffpfieqgrdaigligyvlrkvfygk

SCOPe Domain Coordinates for d3ainc_:

Click to download the PDB-style file with coordinates for d3ainc_.
(The format of our PDB-style files is described here.)

Timeline for d3ainc_: