Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (91 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:111955] [226148] (5 PDB entries) |
Domain d3aimb_: 3aim B: [208230] automated match to d1evqa_ complexed with mpd, mrd, po4; mutant |
PDB Entry: 3aim (more details), 2.3 Å
SCOPe Domain Sequences for d3aimb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aimb_ c.69.1.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 111955]} asveeirslfkqfssltpreevgkieditipgsetnikarvyypktqgpygvlvyyhggg fvlgdiesydplcraitnscqcvtisvdyrlapenkfpaavvdsfdalkwvynnsekfng kygiavggdsaggnlaavtailskkeniklkyqvliypavsfdlitkslydngegffltr ehidwfgqqylrsfadlldfrfspiladlndlppaliitaehdplrdqgeayankllqsg vqvtsvefnnvihgfvsffpfieqgrdaigligyvlrkvfygk
Timeline for d3aimb_: