SCOP 1.55: Domain d1fg2d1: 1fg2 D:182-274

Lineage for d1fg2d1 (1fg2 D:182-274)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (5 PDB entries)

8. Domain d1fg2d1: 1fg2 D:182-274 [20823]
   Other proteins in same PDB: d1fg2a2, d1fg2d2, d1fg2g2, d1fg2j2

Details for d1fg2d1

PDB Entry: 1fg2, 2.75 Å

PDB Description: crystal structure of the lcmv peptidic epitope gp33 in complex with the murine class i mhc molecule h-2db

SCOP Domain Sequences for d1fg2d1:

Sequence; same for both SEQRES and ATOM records:

>d1fg2d1 b.1.1.2 (D:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

Timeline for d1fg2d1:

• d1fg2d1 appears in SCOP 1.57
  
• d1fg2d1 appears in the current release, SCOPe 2.08