SCOPe 2.06: Domain d3aila_: 3ail A:

Lineage for d3aila_ (3ail A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (91 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:111955] [226148] (5 PDB entries)

8. Domain d3aila_: 3ail A: [208225]
   automated match to d1evqa_
   complexed with dep, mrd, po4

Details for d3aila_

PDB Entry: 3ail, 1.91 Å

PDB Description: Crystal structure of a HSL-like carboxylesterase from Sulfolobus tokodaii complexed with paraoxon

PDB Compounds: (A:) 303aa long hypothetical esterase

SCOPe Domain Sequences for d3aila_:

Sequence; same for both SEQRES and ATOM records:

>d3aila_ c.69.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 111955]}
asveeirslfkqfssltpreevgkieditipgsetnikarvyypktqgpygvlvyyhggg
fvlgdiesydplcraitnscqcvtisvdyrlapenkfpaavvdsfdalkwvynnsekfng
kygiavggdsaggnlaavtailskkeniklkyqvliypavsfdlitkslydngegffltr
ehidwfgqqylrsfadlldfrfspiladlndlppaliitaehdplrdqgeayankllqsg
vqvtsvrfnnvihgfvsffpfieqgrdaigligyvlrkvfygk

Timeline for d3aila_:

• d3aila_ first appeared in SCOPe 2.03
  
• d3aila_ appears in SCOPe 2.05
  
• d3aila_ appears in SCOPe 2.07
  
• d3aila_ appears in the current release, SCOPe 2.08