SCOPe 2.05: Domain d3ahyd_: 3ahy D:

Lineage for d3ahyd_ (3ahy D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (72 species)
   not a true protein

7. Species Trichoderma reesei [TaxId:51453] [225935] (5 PDB entries)

8. Domain d3ahyd_: 3ahy D: [208220]
   automated match to d4atda_
   complexed with trs

Details for d3ahyd_

PDB Entry: 3ahy, 1.63 Å

PDB Description: Crystal structure of beta-glucosidase 2 from fungus Trichoderma reesei in complex with Tris

PDB Compounds: (D:) Beta-glucosidase

SCOPe Domain Sequences for d3ahyd_:

Sequence; same for both SEQRES and ATOM records:

>d3ahyd_ c.1.8.0 (D:) automated matches {Trichoderma reesei [TaxId: 51453]}
mlpkdfqwgfataayqiegavdqdgrgpsiwdtfcaqpgkiadgssgvtacdsynrtaed
iallkslgaksyrfsiswsriipeggrgdavnqagidhyvkfvddlldagitpfitlfhw
dlpeglhqryggllnrtefpldfenyarvmfralpkvrnwitfneplcsaipgygsgtfa
pgrqstsepwtvghnilvahgravkayrddfkpasgdgqigivlngdftypwdaadpadk
eaaerrlefftawfadpiylgdypasmrkqlgdrlptftpeeralvhgsndfygmnhyts
nyirhrsspasaddtvgnvdvlftnkqgncigpetqspwlrpcaagfrdflvwiskrygy
ppiyvtengtsikgesdlpkekileddfrvkyyneyiramvtaveldgvnvkgyfawslm
dnfewadgyvtrfgvtyvdyengqkrfpkksakslkplfdeliaa

Timeline for d3ahyd_:

• d3ahyd_ first appeared in SCOPe 2.03
  
• d3ahyd_ appears in SCOPe 2.04
  
• d3ahyd_ appears in SCOPe 2.06
  
• d3ahyd_ appears in the current release, SCOPe 2.08