Lineage for d1fg2b1 (1fg2 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 52919Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 53069Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (5 PDB entries)
  8. 53077Domain d1fg2b1: 1fg2 B: [20822]
    Other proteins in same PDB: d1fg2a2, d1fg2d2, d1fg2g2, d1fg2j2

Details for d1fg2b1

PDB Entry: 1fg2 (more details), 2.75 Å

PDB Description: crystal structure of the lcmv peptidic epitope gp33 in complex with the murine class i mhc molecule h-2db

SCOP Domain Sequences for d1fg2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fg2b1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1fg2b1:

Click to download the PDB-style file with coordinates for d1fg2b1.
(The format of our PDB-style files is described here.)

Timeline for d1fg2b1: