Lineage for d3ahyc1 (3ahy C:1-464)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2833270Species Trichoderma reesei [TaxId:51453] [225935] (5 PDB entries)
  8. 2833275Domain d3ahyc1: 3ahy C:1-464 [208219]
    Other proteins in same PDB: d3ahyb2, d3ahyc2
    automated match to d4atda_
    complexed with trs

Details for d3ahyc1

PDB Entry: 3ahy (more details), 1.63 Å

PDB Description: Crystal structure of beta-glucosidase 2 from fungus Trichoderma reesei in complex with Tris
PDB Compounds: (C:) Beta-glucosidase

SCOPe Domain Sequences for d3ahyc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ahyc1 c.1.8.0 (C:1-464) automated matches {Trichoderma reesei [TaxId: 51453]}
mlpkdfqwgfataayqiegavdqdgrgpsiwdtfcaqpgkiadgssgvtacdsynrtaed
iallkslgaksyrfsiswsriipeggrgdavnqagidhyvkfvddlldagitpfitlfhw
dlpeglhqryggllnrtefpldfenyarvmfralpkvrnwitfneplcsaipgygsgtfa
pgrqstsepwtvghnilvahgravkayrddfkpasgdgqigivlngdftypwdaadpadk
eaaerrlefftawfadpiylgdypasmrkqlgdrlptftpeeralvhgsndfygmnhyts
nyirhrsspasaddtvgnvdvlftnkqgncigpetqspwlrpcaagfrdflvwiskrygy
ppiyvtengtsikgesdlpkekileddfrvkyyneyiramvtaveldgvnvkgyfawslm
dnfewadgyvtrfgvtyvdyengqkrfpkksakslkplfdelia

SCOPe Domain Coordinates for d3ahyc1:

Click to download the PDB-style file with coordinates for d3ahyc1.
(The format of our PDB-style files is described here.)

Timeline for d3ahyc1: