SCOPe 2.03: Domain d3agxb2: 3agx B:246-340

Lineage for d3agxb2 (3agx B:246-340)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families)

5. Family b.4.1.0: automated matches [227209] (1 protein)
   not a true family

6. Protein automated matches [226943] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225489] (2 PDB entries)

8. Domain d3agxb2: 3agx B:246-340 [208212]
   automated match to d1c3ga2

Details for d3agxb2

PDB Entry: 3agx, 1.85 Å

PDB Description: Crystal structure of human Hsp40 Hdj1 peptide-binding domain

PDB Compounds: (B:) DnaJ homolog subfamily B member 1

SCOPe Domain Sequences for d3agxb2:

Sequence; same for both SEQRES and ATOM records:

>d3agxb2 b.4.1.0 (B:246-340) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifkrdgsdviyparislrealcgctvnvptldgrtipvvfkdvirpgmrrkvpgeglplp
ktpekrgdliiefevifperipqtsrtvleqvlpi

Timeline for d3agxb2:

• d3agxb2 is new in SCOPe 2.03-stable
  
• d3agxb2 appears in SCOPe 2.04
  
• d3agxb2 appears in the current release, SCOPe 2.08