![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily) sandwich; 6 strands in 2 sheets |
![]() | Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families) ![]() |
![]() | Family b.4.1.0: automated matches [227209] (1 protein) not a true family |
![]() | Protein automated matches [226943] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225489] (2 PDB entries) |
![]() | Domain d3agxb2: 3agx B:246-340 [208212] automated match to d1c3ga2 |
PDB Entry: 3agx (more details), 1.85 Å
SCOPe Domain Sequences for d3agxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3agxb2 b.4.1.0 (B:246-340) automated matches {Human (Homo sapiens) [TaxId: 9606]} ifkrdgsdviyparislrealcgctvnvptldgrtipvvfkdvirpgmrrkvpgeglplp ktpekrgdliiefevifperipqtsrtvleqvlpi
Timeline for d3agxb2: