Lineage for d3agxb1 (3agx B:165-245)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770358Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
    sandwich; 6 strands in 2 sheets
  4. 2770359Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families) (S)
  5. 2770373Family b.4.1.0: automated matches [227209] (1 protein)
    not a true family
  6. 2770374Protein automated matches [226943] (2 species)
    not a true protein
  7. 2770380Species Human (Homo sapiens) [TaxId:9606] [225489] (2 PDB entries)
  8. 2770383Domain d3agxb1: 3agx B:165-245 [208211]
    automated match to d1c3ga1

Details for d3agxb1

PDB Entry: 3agx (more details), 1.85 Å

PDB Description: Crystal structure of human Hsp40 Hdj1 peptide-binding domain
PDB Compounds: (B:) DnaJ homolog subfamily B member 1

SCOPe Domain Sequences for d3agxb1:

Sequence, based on SEQRES records: (download)

>d3agxb1 b.4.1.0 (B:165-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
thdlrvsleeiysgctkkmkishkrlnpdgksirnedkiltievkkgwkegtkitfpkeg
dqtsnnipadivfvlkdkphn

Sequence, based on observed residues (ATOM records): (download)

>d3agxb1 b.4.1.0 (B:165-245) automated matches {Human (Homo sapiens) [TaxId: 9606]}
thdlrvsleeiysgctkkmkiltievkkgwkegtkitfpkadivfvlkdkphn

SCOPe Domain Coordinates for d3agxb1:

Click to download the PDB-style file with coordinates for d3agxb1.
(The format of our PDB-style files is described here.)

Timeline for d3agxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3agxb2