SCOPe 2.08: Domain d3agxa2: 3agx A:246-340

Lineage for d3agxa2 (3agx A:246-340)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (2 families)

5. Family b.4.1.0: automated matches [227209] (1 protein)
   not a true family

6. Protein automated matches [226943] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225489] (2 PDB entries)

8. Domain d3agxa2: 3agx A:246-340 [208210]
   automated match to d1c3ga2

Details for d3agxa2

PDB Entry: 3agx, 1.85 Å

PDB Description: Crystal structure of human Hsp40 Hdj1 peptide-binding domain

PDB Compounds: (A:) DnaJ homolog subfamily B member 1

SCOPe Domain Sequences for d3agxa2:

Sequence; same for both SEQRES and ATOM records:

>d3agxa2 b.4.1.0 (A:246-340) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifkrdgsdviyparislrealcgctvnvptldgrtipvvfkdvirpgmrrkvpgeglplp
ktpekrgdliiefevifperipqtsrtvleqvlpi

Timeline for d3agxa2:

• d3agxa2 first appeared in SCOPe 2.03
  
• d3agxa2 appears in SCOPe 2.07