SCOPe 2.07: Domain d1fg2a1: 1fg2 A:182-274

Lineage for d1fg2a1 (1fg2 A:182-274)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
   Uniprot P01901 22-299

8. Domain d1fg2a1: 1fg2 A:182-274 [20821]
   Other proteins in same PDB: d1fg2a2, d1fg2b_, d1fg2d2, d1fg2e_, d1fg2g2, d1fg2h_, d1fg2j2, d1fg2k_

Details for d1fg2a1

PDB Entry: 1fg2, 2.75 Å

PDB Description: crystal structure of the lcmv peptidic epitope gp33 in complex with the murine class i mhc molecule h-2db

PDB Compounds: (A:) H-2 class I histocompatibility antigen, D-B alpha chain

SCOPe Domain Sequences for d1fg2a1:

Sequence; same for both SEQRES and ATOM records:

>d1fg2a1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

Timeline for d1fg2a1:

• d1fg2a1 first appeared (with stable ids) in SCOP 1.55
  
• d1fg2a1 appears in SCOPe 2.06
  
• d1fg2a1 appears in the current release, SCOPe 2.08