Lineage for d3agva1 (3agv A:241-339)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1517226Protein automated matches [190374] (9 species)
    not a true protein
  7. 1517240Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)
  8. 1517474Domain d3agva1: 3agv A:241-339 [208205]
    automated match to d2ql1a1
    protein/RNA complex; complexed with ca

Details for d3agva1

PDB Entry: 3agv (more details), 2.15 Å

PDB Description: crystal structure of a human igg-aptamer complex
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d3agva1:

Sequence, based on SEQRES records: (download)

>d3agva1 b.1.1.2 (A:241-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
flfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynsty
rvvsvltvlhqdwlngkeykckvsnkalpapiektiska

Sequence, based on observed residues (ATOM records): (download)

>d3agva1 b.1.1.2 (A:241-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
flfppkpkdtlmisrtpevtcvevkfnwyvdgvevhnaktkpreeqyvvsvltvlhqdwl
ngkeykcktiska

SCOPe Domain Coordinates for d3agva1:

Click to download the PDB-style file with coordinates for d3agva1.
(The format of our PDB-style files is described here.)

Timeline for d3agva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3agva2