Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
Domain d3agva1: 3agv A:241-339 [208205] automated match to d2ql1a1 protein/RNA complex; complexed with ca |
PDB Entry: 3agv (more details), 2.15 Å
SCOPe Domain Sequences for d3agva1:
Sequence, based on SEQRES records: (download)
>d3agva1 b.1.1.2 (A:241-339) automated matches {Human (Homo sapiens) [TaxId: 9606]} flfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynsty rvvsvltvlhqdwlngkeykckvsnkalpapiektiska
>d3agva1 b.1.1.2 (A:241-339) automated matches {Human (Homo sapiens) [TaxId: 9606]} flfppkpkdtlmisrtpevtcvevkfnwyvdgvevhnaktkpreeqyvvsvltvlhqdwl ngkeykcktiska
Timeline for d3agva1: