Lineage for d3ag0a_ (3ag0 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299456Protein Cytoglobin [109626] (1 species)
  7. 2299457Species Human (Homo sapiens) [TaxId:9606] [109627] (8 PDB entries)
    Uniprot Q8WWM9 18-171
  8. 2299470Domain d3ag0a_: 3ag0 A: [208201]
    automated match to d1ut0b_
    complexed with cmo, hem

Details for d3ag0a_

PDB Entry: 3ag0 (more details), 2.6 Å

PDB Description: Crystal structure of carbonmonoxy humnan cytoglobin
PDB Compounds: (A:) cytoglobin

SCOPe Domain Sequences for d3ag0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ag0a_ a.1.1.2 (A:) Cytoglobin {Human (Homo sapiens) [TaxId: 9606]}
elseaerkavqamwarlyancedvgvailvrffvnfpsakqyfsqfkhmedplemerspq
lrkhacrvmgalntvvenlhdpdkvssvlalvgkahalkhkvepvyfkilsgvilevvae
efasdfppetqrawaklrgliyshvtaaykevgwvqqv

SCOPe Domain Coordinates for d3ag0a_:

Click to download the PDB-style file with coordinates for d3ag0a_.
(The format of our PDB-style files is described here.)

Timeline for d3ag0a_: