SCOPe 2.08: Domain d3aevb1: 3aev B:26-115

Lineage for d3aevb1 (3aev B:26-115)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
   beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families)
   Prokaryotic and eukaryotic domains share a KH-motif but have different topologies

5. Family d.51.1.0: automated matches [227159] (1 protein)
   not a true family

6. Protein automated matches [226866] (4 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [225879] (1 PDB entry)

8. Domain d3aevb1: 3aev B:26-115 [208199]
   automated match to d1tuaa1
   protein/RNA complex

Details for d3aevb1

PDB Entry: 3aev, 2.8 Å

PDB Description: Crystal structure of a/eIF2alpha-aDim2p-rRNA complex from Pyrococcus horikoshii OT3

PDB Compounds: (B:) Putative uncharacterized protein PH1566

SCOPe Domain Sequences for d3aevb1:

Sequence; same for both SEQRES and ATOM records:

>d3aevb1 d.51.1.0 (B:26-115) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
deweeffkqeeyvkipkdriavligkkgqtkkeiekrtktkitidsetgevwitstkete
dplavwkardivlaigrgfsperafrllne

Timeline for d3aevb1:

• d3aevb1 first appeared in SCOPe 2.03
  
• d3aevb1 appears in SCOPe 2.07