SCOPe 2.08: Domain d3ab3c2: 3ab3 C:76-201

Lineage for d3ab3c2 (3ab3 C:76-201)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140674] (5 PDB entries)
   Uniprot P21279 67-183! Uniprot P27600 82-203! Uniprot P27601 76-201

8. Domain d3ab3c2: 3ab3 C:76-201 [208195]
   Other proteins in same PDB: d3ab3a1, d3ab3b_, d3ab3c1
   automated match to d1zcba1
   complexed with alf, gdp, mg

Details for d3ab3c2

PDB Entry: 3ab3, 2.4 Å

PDB Description: crystal structure of p115rhogef rgs domain in complex with g alpha 13

PDB Compounds: (C:) Guanine nucleotide-binding protein G(k) subunit alpha, Guanine nucleotide-binding protein subunit alpha-13

SCOPe Domain Sequences for d3ab3c2:

Sequence; same for both SEQRES and ATOM records:

>d3ab3c2 a.66.1.1 (C:76-201) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]}
fdqrareefrptiysnvikgmrvlvdareklhipwgdnknqlhgdklmafdtrapmaaqg
mvetrvflqylpairalwedsgiqnaydrrrefqlgesvkyfldnldklgvpdyipsqqd
illarr

Timeline for d3ab3c2:

• d3ab3c2 first appeared in SCOPe 2.03
  
• d3ab3c2 appears in SCOPe 2.07