Lineage for d3aazl1 (3aaz L:1-112)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765593Domain d3aazl1: 3aaz L:1-112 [208190]
    automated match to d1dqdl1

Details for d3aazl1

PDB Entry: 3aaz (more details), 2.2 Å

PDB Description: Crystal structure of the humanized recombinant Fab fragment of a murine; antibody
PDB Compounds: (L:) Humanized recombinant Fab fragment of a murine; antibody

SCOPe Domain Sequences for d3aazl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aazl1 b.1.1.0 (L:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqsplslpvtpgepasiscrssqsivhsnghtylewylqkpgqsprlliyqvstrf
sgvpdrfsgsgsgtdftlkisrveaedvgvyycfqaslvpltfgqgtkleik

SCOPe Domain Coordinates for d3aazl1:

Click to download the PDB-style file with coordinates for d3aazl1.
(The format of our PDB-style files is described here.)

Timeline for d3aazl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3aazl2