Lineage for d3aajb_ (3aaj B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2710066Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 2710067Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 2711591Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 2711592Protein automated matches [190513] (36 species)
    not a true protein
  7. 2711650Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries)
  8. 2711674Domain d3aajb_: 3aaj B: [208185]
    automated match to d1juoa_
    complexed with ca

Details for d3aajb_

PDB Entry: 3aaj (more details), 2.4 Å

PDB Description: Crystal structure of Ca2+-bound form of des3-23ALG-2deltaGF122
PDB Compounds: (B:) programmed cell death protein 6

SCOPe Domain Sequences for d3aajb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aajb_ a.39.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lwnvfqrvdkdrsgvisdtelqqalsngtwtpfnpvtvrsiismfdrenkagvnfseftg
vwkyitdwqnvfrtydrdnsgmidknelkqalsgyrlsdqfhdilirkfdrqgrgqiafd
dfiqgcivlqrltdifrrydtdqdgwiqvsyeqylsmvfsiv

SCOPe Domain Coordinates for d3aajb_:

Click to download the PDB-style file with coordinates for d3aajb_.
(The format of our PDB-style files is described here.)

Timeline for d3aajb_: