![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.15: HSP20-like chaperones [49763] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
![]() | Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) ![]() |
![]() | Family b.15.1.0: automated matches [191643] (1 protein) not a true family |
![]() | Protein automated matches [191181] (10 species) not a true protein |
![]() | Species Sulfolobus tokodaii [TaxId:273063] [226008] (3 PDB entries) |
![]() | Domain d3aaca_: 3aac A: [208182] automated match to d1shsa_ mutant |
PDB Entry: 3aac (more details), 2.4 Å
SCOPe Domain Sequences for d3aaca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aaca_ b.15.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]} myylgkelqkrseelsrgfyelvyppvdmyeeggylvvvadlagfnkekikarvsgqnel iieaereitepgvkyltqrpkyvrkvirlpynvakdaeisgkyengvltiripiagtsvf kfe
Timeline for d3aaca_: