Class b: All beta proteins [48724] (174 folds) |
Fold b.15: HSP20-like chaperones [49763] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) |
Family b.15.1.0: automated matches [191643] (1 protein) not a true family |
Protein automated matches [191181] (3 species) not a true protein |
Species Sulfolobus tokodaii [TaxId:273063] [226008] (3 PDB entries) |
Domain d3aabb_: 3aab B: [208181] automated match to d1shsa_ complexed with gol, ipa; mutant |
PDB Entry: 3aab (more details), 1.85 Å
SCOPe Domain Sequences for d3aabb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aabb_ b.15.1.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 273063]} qkrseelsrgfyelvyppvdmyeeggylvvvadlagfnkekikarvsgqneliieaerei tepgvkyltqrpkyvrkvirlpynvakdaeisgkyengvltiripi
Timeline for d3aabb_: