Lineage for d3aabb_ (3aab B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773837Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773838Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 2773941Family b.15.1.0: automated matches [191643] (1 protein)
    not a true family
  6. 2773942Protein automated matches [191181] (10 species)
    not a true protein
  7. 2773977Species Sulfolobus tokodaii [TaxId:273063] [226008] (3 PDB entries)
  8. 2773979Domain d3aabb_: 3aab B: [208181]
    automated match to d1shsa_
    complexed with gol, ipa; mutant

Details for d3aabb_

PDB Entry: 3aab (more details), 1.85 Å

PDB Description: Small heat shock protein hsp14.0 with the mutations of I120F and I122F in the form I crystal
PDB Compounds: (B:) Putative uncharacterized protein ST1653

SCOPe Domain Sequences for d3aabb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aabb_ b.15.1.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
qkrseelsrgfyelvyppvdmyeeggylvvvadlagfnkekikarvsgqneliieaerei
tepgvkyltqrpkyvrkvirlpynvakdaeisgkyengvltiripi

SCOPe Domain Coordinates for d3aabb_:

Click to download the PDB-style file with coordinates for d3aabb_.
(The format of our PDB-style files is described here.)

Timeline for d3aabb_: