| Class b: All beta proteins [48724] (176 folds) |
| Fold b.15: HSP20-like chaperones [49763] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) ![]() |
| Family b.15.1.0: automated matches [191643] (1 protein) not a true family |
| Protein automated matches [191181] (4 species) not a true protein |
| Species Sulfolobus tokodaii [TaxId:273063] [226008] (3 PDB entries) |
| Domain d3aaba_: 3aab A: [208180] automated match to d1shsa_ complexed with gol, ipa; mutant |
PDB Entry: 3aab (more details), 1.85 Å
SCOPe Domain Sequences for d3aaba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aaba_ b.15.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
elsrgfyelvyppvdmyeeggylvvvadlagfnkekikarvsgqneliieaereitepgv
kyltqrpkyvrkvirlpynvakdaeisgkyengvltiripiagtsvfkfe
Timeline for d3aaba_: