SCOPe 2.08: Domain d3aaba_: 3aab A:

Lineage for d3aaba_ (3aab A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.15.1: HSP20-like chaperones [49764] (5 families)

5. Family b.15.1.0: automated matches [191643] (1 protein)
   not a true family

6. Protein automated matches [191181] (10 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [226008] (3 PDB entries)

8. Domain d3aaba_: 3aab A: [208180]
   automated match to d1shsa_
   complexed with gol, ipa; mutant

Details for d3aaba_

PDB Entry: 3aab, 1.85 Å

PDB Description: Small heat shock protein hsp14.0 with the mutations of I120F and I122F in the form I crystal

PDB Compounds: (A:) Putative uncharacterized protein ST1653

SCOPe Domain Sequences for d3aaba_:

Sequence; same for both SEQRES and ATOM records:

>d3aaba_ b.15.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
elsrgfyelvyppvdmyeeggylvvvadlagfnkekikarvsgqneliieaereitepgv
kyltqrpkyvrkvirlpynvakdaeisgkyengvltiripiagtsvfkfe

Timeline for d3aaba_:

• d3aaba_ first appeared in SCOPe 2.03
  
• d3aaba_ appears in SCOPe 2.07