Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein beta2-microglobulin [88600] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88602] (67 PDB entries) |
Domain d1qlfb_: 1qlf B: [20818] Other proteins in same PDB: d1qlfa1, d1qlfa2 complexed with gol, nag, so4 |
PDB Entry: 1qlf (more details), 2.65 Å
SCOP Domain Sequences for d1qlfb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlfb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens)} iqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskdw sfyllyyteftptekdeyacrvnhvtlsqpkivkwdrdm
Timeline for d1qlfb_: