SCOPe 2.03: Domain d3a9tc1: 3a9t C:2-360

Lineage for d3a9tc1 (3a9t C:2-360)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily)
   consists of two domains of similar topology, 3 layers (a/b/a) each
   Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345
   Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families)

5. Family c.85.1.0: automated matches [227251] (1 protein)
   not a true family

6. Protein automated matches [227031] (2 species)
   not a true protein

7. Species Geobacillus pallidus [TaxId:33936] [225862] (3 PDB entries)

8. Domain d3a9tc1: 3a9t C:2-360 [208176]
   Other proteins in same PDB: d3a9ta2, d3a9tb2, d3a9tc2
   automated match to d1fuia2
   complexed with foc, mn

Details for d3a9tc1

PDB Entry: 3a9t, 2.61 Å

PDB Description: x-ray structure of bacillus pallidus d-arabinose isomerase complex with l-fucitol

PDB Compounds: (C:) D-arabinose isomerase

SCOPe Domain Sequences for d3a9tc1:

Sequence; same for both SEQRES and ATOM records:

>d3a9tc1 c.85.1.0 (C:2-360) automated matches {Geobacillus pallidus [TaxId: 33936]}
akdpryvgnlpkigirptidgrrkgvresleettmnmakavaklleenvfyyngqpvecv
iadtciggvkeaaeaaekfaregvgvsitvtpcwcygtetmdmdphipkavwgfngterp
gavylaavlagynqkglpafgiygkdvqdagdtnipedvkeklirfakaglavammkgks
ylsigsvsmgiagsvvqedffqnylgmrneyvdmsefvrrielgiydkeeyeralkwvke
nckvgpdnnrdgfkrteeqkekdweisvkmaliardlmvgnkkleemgygeealgrnaiv
agfqgqrqwtdyfpngdfmetilnssfdwngkrapyifatendnlngismlfgylltnt

Timeline for d3a9tc1:

• d3a9tc1 is new in SCOPe 2.03-stable
  
• d3a9tc1 appears in SCOPe 2.04
  
• d3a9tc1 appears in the current release, SCOPe 2.08