SCOPe 2.06: Domain d3a9tb2: 3a9t B:361-590

Lineage for d3a9tb2 (3a9t B:361-590)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families)

5. Family b.43.2.0: automated matches [227252] (1 protein)
   not a true family

6. Protein automated matches [227032] (4 species)
   not a true protein

7. Species Geobacillus pallidus [TaxId:33936] [225863] (3 PDB entries)

8. Domain d3a9tb2: 3a9t B:361-590 [208175]
   Other proteins in same PDB: d3a9ta1, d3a9tb1, d3a9tc1
   automated match to d1fuia1
   complexed with foc, mn

Details for d3a9tb2

PDB Entry: 3a9t, 2.61 Å

PDB Description: x-ray structure of bacillus pallidus d-arabinose isomerase complex with l-fucitol

PDB Compounds: (B:) D-arabinose isomerase

SCOPe Domain Sequences for d3a9tb2:

Sequence; same for both SEQRES and ATOM records:

>d3a9tb2 b.43.2.0 (B:361-590) automated matches {Geobacillus pallidus [TaxId: 33936]}
aqifadvrtywspeavkrvtgytlegraangiihlinsgaaaldgtgeqtkdgkpvikpy
yeltdedikkcleatqfrpasteyfrgggystdfltkggmpvtisrlnivkglgpvlqia
egytvdlpeevhdvldkrtdptwpttwfvpnltgegafkdvysvmnnwganhcsisyghi
gadlitlasilripvnmhnvpeekifrpdawsmfgtkdlegadyrackkl

Timeline for d3a9tb2:

• d3a9tb2 first appeared in SCOPe 2.03
  
• d3a9tb2 appears in SCOPe 2.05
  
• d3a9tb2 appears in SCOPe 2.07
  
• d3a9tb2 appears in the current release, SCOPe 2.08