Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily) consists of two domains of similar topology, 3 layers (a/b/a) each Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345 Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families) |
Family c.85.1.0: automated matches [227251] (1 protein) not a true family |
Protein automated matches [227031] (2 species) not a true protein |
Species Geobacillus pallidus [TaxId:33936] [225862] (3 PDB entries) |
Domain d3a9ta1: 3a9t A:2-360 [208172] Other proteins in same PDB: d3a9ta2, d3a9tb2, d3a9tc2 automated match to d1fuia2 complexed with foc, mn |
PDB Entry: 3a9t (more details), 2.61 Å
SCOPe Domain Sequences for d3a9ta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a9ta1 c.85.1.0 (A:2-360) automated matches {Geobacillus pallidus [TaxId: 33936]} akdpryvgnlpkigirptidgrrkgvresleettmnmakavaklleenvfyyngqpvecv iadtciggvkeaaeaaekfaregvgvsitvtpcwcygtetmdmdphipkavwgfngterp gavylaavlagynqkglpafgiygkdvqdagdtnipedvkeklirfakaglavammkgks ylsigsvsmgiagsvvqedffqnylgmrneyvdmsefvrrielgiydkeeyeralkwvke nckvgpdnnrdgfkrteeqkekdweisvkmaliardlmvgnkkleemgygeealgrnaiv agfqgqrqwtdyfpngdfmetilnssfdwngkrapyifatendnlngismlfgylltnt
Timeline for d3a9ta1:
View in 3D Domains from other chains: (mouse over for more information) d3a9tb1, d3a9tb2, d3a9tc1, d3a9tc2 |