Lineage for d3a9sa2 (3a9s A:361-590)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1791673Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1791674Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families) (S)
  5. 1791693Family b.43.2.0: automated matches [227252] (1 protein)
    not a true family
  6. 1791694Protein automated matches [227032] (4 species)
    not a true protein
  7. 1791718Species Geobacillus pallidus [TaxId:33936] [225863] (3 PDB entries)
  8. 1791719Domain d3a9sa2: 3a9s A:361-590 [208167]
    Other proteins in same PDB: d3a9sa1, d3a9sb1, d3a9sc1
    automated match to d1fuia1
    complexed with gol, mn

Details for d3a9sa2

PDB Entry: 3a9s (more details), 1.6 Å

PDB Description: x-ray structure of bacillus pallidus d-arabinose isomerase complex with glycerol
PDB Compounds: (A:) D-arabinose isomerase

SCOPe Domain Sequences for d3a9sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a9sa2 b.43.2.0 (A:361-590) automated matches {Geobacillus pallidus [TaxId: 33936]}
aqifadvrtywspeavkrvtgytlegraangiihlinsgaaaldgtgeqtkdgkpvikpy
yeltdedikkcleatqfrpasteyfrgggystdfltkggmpvtisrlnivkglgpvlqia
egytvdlpeevhdvldkrtdptwpttwfvpnltgegafkdvysvmnnwganhcsisyghi
gadlitlasilripvnmhnvpeekifrpdawsmfgtkdlegadyrackkl

SCOPe Domain Coordinates for d3a9sa2:

Click to download the PDB-style file with coordinates for d3a9sa2.
(The format of our PDB-style files is described here.)

Timeline for d3a9sa2: