![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily) consists of two domains of similar topology, 3 layers (a/b/a) each Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345 Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families) ![]() |
![]() | Family c.85.1.0: automated matches [227251] (1 protein) not a true family |
![]() | Protein automated matches [227031] (3 species) not a true protein |
![]() | Species Geobacillus pallidus [TaxId:33936] [225862] (3 PDB entries) |
![]() | Domain d3a9rb1: 3a9r B:2-360 [208162] Other proteins in same PDB: d3a9ra2, d3a9rb2, d3a9rc2 automated match to d1fuia2 complexed with mn, mrd |
PDB Entry: 3a9r (more details), 1.77 Å
SCOPe Domain Sequences for d3a9rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a9rb1 c.85.1.0 (B:2-360) automated matches {Geobacillus pallidus [TaxId: 33936]} akdpryvgnlpkigirptidgrrkgvresleettmnmakavaklleenvfyyngqpvecv iadtciggvkeaaeaaekfaregvgvsitvtpcwcygtetmdmdphipkavwgfngterp gavylaavlagynqkglpafgiygkdvqdagdtnipedvkeklirfakaglavammkgks ylsigsvsmgiagsvvqedffqnylgmrneyvdmsefvrrielgiydkeeyeralkwvke nckvgpdnnrdgfkrteeqkekdweisvkmaliardlmvgnkkleemgygeealgrnaiv agfqgqrqwtdyfpngdfmetilnssfdwngkrapyifatendnlngismlfgylltnt
Timeline for d3a9rb1:
![]() Domains from other chains: (mouse over for more information) d3a9ra1, d3a9ra2, d3a9rc1, d3a9rc2 |