Lineage for d3a9ra1 (3a9r A:2-360)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910317Fold c.85: FucI/AraA N-terminal and middle domains [53742] (1 superfamily)
    consists of two domains of similar topology, 3 layers (a/b/a) each
    Domain 1 (1-173) has parallel beta-sheet of 5 strands, order 21345
    Domain 2 (174-355) has parallel beta-sheet of 4 strands, order 2134
  4. 2910318Superfamily c.85.1: FucI/AraA N-terminal and middle domains [53743] (3 families) (S)
  5. 2910356Family c.85.1.0: automated matches [227251] (1 protein)
    not a true family
  6. 2910357Protein automated matches [227031] (3 species)
    not a true protein
  7. 2910377Species Geobacillus pallidus [TaxId:33936] [225862] (3 PDB entries)
  8. 2910381Domain d3a9ra1: 3a9r A:2-360 [208160]
    Other proteins in same PDB: d3a9ra2, d3a9rb2, d3a9rc2
    automated match to d1fuia2
    complexed with mn, mrd

Details for d3a9ra1

PDB Entry: 3a9r (more details), 1.77 Å

PDB Description: x-ray structures of bacillus pallidus d-arabinose isomerasecomplex with (4r)-2-methylpentane-2,4-diol
PDB Compounds: (A:) D-arabinose isomerase

SCOPe Domain Sequences for d3a9ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a9ra1 c.85.1.0 (A:2-360) automated matches {Geobacillus pallidus [TaxId: 33936]}
akdpryvgnlpkigirptidgrrkgvresleettmnmakavaklleenvfyyngqpvecv
iadtciggvkeaaeaaekfaregvgvsitvtpcwcygtetmdmdphipkavwgfngterp
gavylaavlagynqkglpafgiygkdvqdagdtnipedvkeklirfakaglavammkgks
ylsigsvsmgiagsvvqedffqnylgmrneyvdmsefvrrielgiydkeeyeralkwvke
nckvgpdnnrdgfkrteeqkekdweisvkmaliardlmvgnkkleemgygeealgrnaiv
agfqgqrqwtdyfpngdfmetilnssfdwngkrapyifatendnlngismlfgylltnt

SCOPe Domain Coordinates for d3a9ra1:

Click to download the PDB-style file with coordinates for d3a9ra1.
(The format of our PDB-style files is described here.)

Timeline for d3a9ra1: