SCOPe 2.05: Domain d1hocb_: 1hoc B:

Lineage for d1hocb_ (1hoc B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (174 PDB entries)
   Uniprot P01887

8. Domain d1hocb_: 1hoc B: [20816]
   Other proteins in same PDB: d1hoca1, d1hoca2

Details for d1hocb_

PDB Entry: 1hoc, 2.4 Å

PDB Description: the three-dimensional structure of h-2db at 2.4 angstroms resolution: implications for antigen-determinant selection

PDB Compounds: (B:) beta 2-microglobulin

SCOPe Domain Sequences for d1hocb_:

Sequence; same for both SEQRES and ATOM records:

>d1hocb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1hocb_:

• d1hocb_ first appeared (with stable ids) in SCOP 1.55, called d1hocb1
  
• d1hocb_ appears in SCOPe 2.04
  
• d1hocb_ appears in SCOPe 2.06
  
• d1hocb_ appears in the current release, SCOPe 2.08