Class b: All beta proteins [48724] (93 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) |
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (5 PDB entries) |
Domain d1hocb1: 1hoc B: [20816] Other proteins in same PDB: d1hoca2 |
PDB Entry: 1hoc (more details), 2.4 Å
SCOP Domain Sequences for d1hocb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hocb1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1hocb1: