Lineage for d1hocb1 (1hoc B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8170Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 8302Species Mouse (Mus musculus), H-2DB [TaxId:10090] [48960] (5 PDB entries)
  8. 8304Domain d1hocb1: 1hoc B: [20816]
    Other proteins in same PDB: d1hoca2

Details for d1hocb1

PDB Entry: 1hoc (more details), 2.4 Å

PDB Description: the three-dimensional structure of h-2db at 2.4 angstroms resolution: implications for antigen-determinant selection

SCOP Domain Sequences for d1hocb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hocb1 b.1.1.2 (B:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2DB}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1hocb1:

Click to download the PDB-style file with coordinates for d1hocb1.
(The format of our PDB-style files is described here.)

Timeline for d1hocb1: