| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species) OPK group(?); PIM subfamily; serine/threonine kinase |
| Species Human (Homo sapiens) [TaxId:9606] [118134] (118 PDB entries) Uniprot P11309 33-305 ! Uniprot P11309 32-308 |
| Domain d3a99a_: 3a99 A: [208158] automated match to d2f2cb_ complexed with anp, mg |
PDB Entry: 3a99 (more details), 1.6 Å
SCOPe Domain Sequences for d3a99a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a99a_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
plesqyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvl
lkkvssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvl
eavrhchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppew
iryhryhgrsaavwslgillydmvcgdipfehdeeiirgqvffrqrvssecqhlirwcla
lrpsdrptfeeiqnhpwmqdvllpqetaeihlh
Timeline for d3a99a_: