Lineage for d1hoca1 (1hoc A:182-272)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548582Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 548690Species Mouse (Mus musculus) [TaxId:10090] [88606] (66 PDB entries)
  8. 548744Domain d1hoca1: 1hoc A:182-272 [20815]
    Other proteins in same PDB: d1hoca2, d1hocb_

Details for d1hoca1

PDB Entry: 1hoc (more details), 2.4 Å

PDB Description: the three-dimensional structure of h-2db at 2.4 angstroms resolution: implications for antigen-determinant selection

SCOP Domain Sequences for d1hoca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hoca1 b.1.1.2 (A:182-272) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltl

SCOP Domain Coordinates for d1hoca1:

Click to download the PDB-style file with coordinates for d1hoca1.
(The format of our PDB-style files is described here.)

Timeline for d1hoca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hoca2
View in 3D
Domains from other chains:
(mouse over for more information)
d1hocb_