![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.3: LplA-like [143642] (6 proteins) part of Pfam PF03099 |
![]() | Protein Two-domain LplA, N-terminal domain [160607] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [160608] (5 PDB entries) Uniprot P32099 1-246 |
![]() | Domain d3a7ra1: 3a7r A:1-246 [208148] Other proteins in same PDB: d3a7ra2 automated match to d1x2ga2 complexed with laq, mg, so4 |
PDB Entry: 3a7r (more details), 2.05 Å
SCOPe Domain Sequences for d3a7ra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a7ra1 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]} stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss wewnfg
Timeline for d3a7ra1: