Lineage for d3a7ra1 (3a7r A:1-246)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208545Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2208546Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2208884Family d.104.1.3: LplA-like [143642] (6 proteins)
    part of Pfam PF03099
  6. 2208901Protein Two-domain LplA, N-terminal domain [160607] (1 species)
  7. 2208902Species Escherichia coli [TaxId:562] [160608] (5 PDB entries)
    Uniprot P32099 1-246
  8. 2208903Domain d3a7ra1: 3a7r A:1-246 [208148]
    Other proteins in same PDB: d3a7ra2
    automated match to d1x2ga2
    complexed with laq, mg, so4

Details for d3a7ra1

PDB Entry: 3a7r (more details), 2.05 Å

PDB Description: Crystal structure of E. coli lipoate-protein ligase A in complex with lipoyl-AMP.
PDB Compounds: (A:) Lipoate-protein ligase A

SCOPe Domain Sequences for d3a7ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a7ra1 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]}
stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
wewnfg

SCOPe Domain Coordinates for d3a7ra1:

Click to download the PDB-style file with coordinates for d3a7ra1.
(The format of our PDB-style files is described here.)

Timeline for d3a7ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3a7ra2