SCOPe 2.08: Domain d3a7ra1: 3a7r A:1-246

Lineage for d3a7ra1 (3a7r A:1-246)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.3: LplA-like [143642] (6 proteins)
   part of Pfam PF03099

6. Protein Two-domain LplA, N-terminal domain [160607] (1 species)

7. Species Escherichia coli [TaxId:562] [160608] (5 PDB entries)
   Uniprot P32099 1-246

8. Domain d3a7ra1: 3a7r A:1-246 [208148]
   Other proteins in same PDB: d3a7ra2
   automated match to d1x2ga2
   complexed with laq, mg, so4

Details for d3a7ra1

PDB Entry: 3a7r, 2.05 Å

PDB Description: Crystal structure of E. coli lipoate-protein ligase A in complex with lipoyl-AMP.

PDB Compounds: (A:) Lipoate-protein ligase A

SCOPe Domain Sequences for d3a7ra1:

Sequence; same for both SEQRES and ATOM records:

>d3a7ra1 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]}
stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
wewnfg

Timeline for d3a7ra1:

• d3a7ra1 first appeared in SCOPe 2.03
  
• d3a7ra1 appears in SCOPe 2.07