SCOPe 2.05: Domain d3a7ia_: 3a7i A:

Lineage for d3a7ia_ (3a7i A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (615 PDB entries)

8. Domain d3a7ia_: 3a7i A: [208146]
   automated match to d4appa_
   complexed with ade

Details for d3a7ia_

PDB Entry: 3a7i, 1.45 Å

PDB Description: Human MST3 kinase in complex with adenine

PDB Compounds: (A:) Serine/threonine kinase 24 (STE20 homolog, yeast)

SCOPe Domain Sequences for d3a7ia_:

Sequence; same for both SEQRES and ATOM records:

>d3a7ia_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqnlkadpeelftklekigkgsfgevfkgidnrtqkvvaikiidleeaedeiediqqeit
vlsqcdspyvtkyygsylkdtklwiimeylgggsaldllepgpldetqiatilreilkgl
dylhsekkihrdikaanvllsehgevkladfgvagqltdtqikrntfvgtpfwmapevik
qsaydskadiwslgitaielargepphselhpmkvlflipknnpptlegnyskplkefve
aclnkepsfrptakellkhkfilrnakktsyltelidrykrwkaeqs

Timeline for d3a7ia_:

• d3a7ia_ first appeared in SCOPe 2.03
  
• d3a7ia_ appears in SCOPe 2.04
  
• d3a7ia_ appears in SCOPe 2.06
  
• d3a7ia_ appears in the current release, SCOPe 2.08