SCOPe 2.03: Domain d3a7gb_: 3a7g B:

Lineage for d3a7gb_ (3a7g B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (18 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (314 PDB entries)

8. Domain d3a7gb_: 3a7g B: [208143]
   automated match to d4appa_

Details for d3a7gb_

PDB Entry: 3a7g, 2 Å

PDB Description: Human MST3 kinase

PDB Compounds: (B:) Serine/threonine kinase 24 (STE20 homolog, yeast)

SCOPe Domain Sequences for d3a7gb_:

Sequence; same for both SEQRES and ATOM records:

>d3a7gb_ d.144.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sglpgmqnlkadpeelftklekigkgsfgevfkgidnrtqkvvaikiidleeaedeiedi
qqeitvlsqcdspyvtkyygsylkdtklwiimeylgggsaldllepgpldetqiatilre
ilkgldylhsekkihrdikaanvllsehgevkladfgvagqltdtqikrntfvgtpfwma
pevikqsaydskadiwslgitaielargepphselhpmkvlflipknnpptlegnyskpl
kefveaclnkepsfrptakellkhkfilrnakktsyltelidrykrwkaeq

Timeline for d3a7gb_:

• d3a7gb_ is new in SCOPe 2.03-stable
  
• d3a7gb_ appears in SCOPe 2.04
  
• d3a7gb_ appears in the current release, SCOPe 2.08