Lineage for d1g6rm_ (1g6r M:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2025134Protein beta2-microglobulin [88600] (6 species)
  7. 2025828Species Mouse (Mus musculus) [TaxId:10090] [88603] (182 PDB entries)
    Uniprot P01887
  8. 2026108Domain d1g6rm_: 1g6r M: [20814]
    Other proteins in same PDB: d1g6ra1, d1g6ra2, d1g6rb1, d1g6rb2, d1g6rc1, d1g6rc2, d1g6rd1, d1g6rd2, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2

Details for d1g6rm_

PDB Entry: 1g6r (more details), 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex
PDB Compounds: (M:) beta-2 microglobulin

SCOPe Domain Sequences for d1g6rm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6rm_ b.1.1.2 (M:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1g6rm_:

Click to download the PDB-style file with coordinates for d1g6rm_.
(The format of our PDB-style files is described here.)

Timeline for d1g6rm_: