SCOPe 2.03: Domain d1g6rm_: 1g6r M:

Lineage for d1g6rm_ (1g6r M:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (155 PDB entries)
   Uniprot P01887

8. Domain d1g6rm_: 1g6r M: [20814]
   Other proteins in same PDB: d1g6ra1, d1g6ra2, d1g6rb1, d1g6rb2, d1g6rc1, d1g6rc2, d1g6rd1, d1g6rd2, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2

Details for d1g6rm_

PDB Entry: 1g6r, 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex

PDB Compounds: (M:) beta-2 microglobulin

SCOPe Domain Sequences for d1g6rm_:

Sequence; same for both SEQRES and ATOM records:

>d1g6rm_ b.1.1.2 (M:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1g6rm_:

• d1g6rm_ first appeared (with stable ids) in SCOP 1.55, called d1g6rm1
  
• d1g6rm_ appears in SCOPe 2.02
  
• d1g6rm_ appears in SCOPe 2.04
  
• d1g6rm_ appears in the current release, SCOPe 2.08