Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (155 PDB entries) Uniprot P01887 |
Domain d1g6rm_: 1g6r M: [20814] Other proteins in same PDB: d1g6ra1, d1g6ra2, d1g6rb1, d1g6rb2, d1g6rc1, d1g6rc2, d1g6rd1, d1g6rd2, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2 |
PDB Entry: 1g6r (more details), 2.8 Å
SCOPe Domain Sequences for d1g6rm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6rm_ b.1.1.2 (M:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1g6rm_: