![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
![]() | Species Mouse (Mus musculus), H-2KB [TaxId:10090] [48959] (22 PDB entries) |
![]() | Domain d1g6rm1: 1g6r M: [20814] Other proteins in same PDB: d1g6ra1, d1g6ra2, d1g6rb1, d1g6rb2, d1g6rc1, d1g6rc2, d1g6rd1, d1g6rd2, d1g6rh2, d1g6ri2 |
PDB Entry: 1g6r (more details), 2.8 Å
SCOP Domain Sequences for d1g6rm1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g6rm1 b.1.1.2 (M:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2KB} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1g6rm1: