Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.1: Anticodon-binding domain [50250] (2 proteins) barrel, closed; n=5, S=10 |
Protein Lysyl-tRNA synthetase (LysRS) [50256] (3 species) |
Species Geobacillus stearothermophilus [TaxId:1422] [225968] (1 PDB entry) |
Domain d3a74d1: 3a74 D:4-145 [208139] Other proteins in same PDB: d3a74a2, d3a74b2, d3a74c2, d3a74d2 automated match to d1bbua1 protein/RNA complex; complexed with b4p, lyn, mg |
PDB Entry: 3a74 (more details), 1.8 Å
SCOPe Domain Sequences for d3a74d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a74d1 b.40.4.1 (D:4-145) Lysyl-tRNA synthetase (LysRS) {Geobacillus stearothermophilus [TaxId: 1422]} elndqlrvrreklkkieelgvdpfgkrferthkaeelfelygdlskeeleeqqievavag rimtkrgmgkagfahiqdvtgqiqiyvrqddvgeqqyelfkisdlgdivgvrgtmfktkv gelsikvssyefltkalrplpe
Timeline for d3a74d1: