SCOPe 2.06: Domain d3a73b1: 3a73 B:2-196

Lineage for d3a73b1 (3a73 B:2-196)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.126: Serum albumin-like [48551] (1 superfamily)
   multihelical; one domain consists of two similar disulfide-linked subdomains

4. Superfamily a.126.1: Serum albumin-like [48552] (2 families)

5. Family a.126.1.1: Serum albumin-like [48553] (2 proteins)

6. Protein Serum albumin [48554] (1 species)
   duplication: consists of three domains of this fold

7. Species Human (Homo sapiens) [TaxId:9606] [48555] (78 PDB entries)
   Uniprot P02768 29-596

8. Domain d3a73b1: 3a73 B:2-196 [208130]
   automated match to d1n5ua1
   complexed with myr, pj2

Details for d3a73b1

PDB Entry: 3a73, 2.19 Å

PDB Description: Crystal Structure Analysis of Human serum albumin complexed with delta 12-prostaglandin J2

PDB Compounds: (B:) serum albumin

SCOPe Domain Sequences for d3a73b1:

Sequence; same for both SEQRES and ATOM records:

>d3a73b1 a.126.1.1 (B:2-196) Serum albumin {Human (Homo sapiens) [TaxId: 9606]}
ahksevahrfkdlgeenfkalvliafaqylqqcpfedhvklvnevtefaktcvadesaen
cdkslhtlfgdklctvatlretygemadccakqepernecflqhkddnpnlprlvrpevd
vmctafhdneetflkkylyeiarrhpyfyapellffakrykaafteccqaadkaacllpk
ldelrdegkassakq

Timeline for d3a73b1:

• d3a73b1 first appeared in SCOPe 2.03
  
• d3a73b1 appears in SCOPe 2.05
  
• d3a73b1 appears in SCOPe 2.07
  
• d3a73b1 appears in the current release, SCOPe 2.08